Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0295200_circ_g.1 |
ID in PlantcircBase | osa_circ_027268 |
Alias | Os_ciR9768 |
Organism | Oryza sativa |
Position | chr5: 13059289-13059540 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder, find_circ |
Parent gene | Os05g0295200 |
Parent gene annotation |
Conserved hypothetical protein. (Os05t0295200-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 2/12 |
Tissues | root/root, seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os05t0295200-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_006113* |
PMCS | 0.23199709 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
13059406-13059464(-) |
Potential amino acid sequence |
MPMMLLLTRNSQLPQGMRFFRLVLSHLAYSLQEVSFFVRLSEYLQQRVMKGGGNHKVYLKVQHL *(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |