Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0295200_circ_g.1 |
| ID in PlantcircBase | osa_circ_027268 |
| Alias | Os_ciR9768 |
| Organism | Oryza sativa |
| Position | chr5: 13059289-13059540 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, find_circ |
| Parent gene | Os05g0295200 |
| Parent gene annotation |
Conserved hypothetical protein. (Os05t0295200-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2/12 |
| Tissues | root/root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0295200-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_006113* |
| PMCS | 0.23199709 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13059406-13059464(-) |
| Potential amino acid sequence |
MPMMLLLTRNSQLPQGMRFFRLVLSHLAYSLQEVSFFVRLSEYLQQRVMKGGGNHKVYLKVQHL *(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |