Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0507400_circ_g.1 |
ID in PlantcircBase | osa_circ_014748 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 18111370-18111473 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os02g0507400 |
Parent gene annotation |
Protein of unknown function DUF493 family protein. (Os02t0507400 -01);Protein of unknown function DUF493 family protein. (Os02t05 07400-02);Similar to OSIGBa0148P16.4 protein. (Os02t0507400-03) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | pistil |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0507400-03:1 Os02t0507400-01:1 Os02t0507400-02:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.215545513 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
18111418-18111372(+) 18111420-18111417(-) |
Potential amino acid sequence |
MGGTVTDDATDEWLVLDKQR*(+) MTTFVVCATRPLEFATSAYPEQAIHQLHHLSQYHP*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |