Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0507400_circ_g.1 |
| ID in PlantcircBase | osa_circ_014748 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 18111370-18111473 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os02g0507400 |
| Parent gene annotation |
Protein of unknown function DUF493 family protein. (Os02t0507400 -01);Protein of unknown function DUF493 family protein. (Os02t05 07400-02);Similar to OSIGBa0148P16.4 protein. (Os02t0507400-03) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0507400-03:1 Os02t0507400-01:1 Os02t0507400-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.215545513 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18111418-18111372(+) 18111420-18111417(-) |
| Potential amino acid sequence |
MGGTVTDDATDEWLVLDKQR*(+) MTTFVVCATRPLEFATSAYPEQAIHQLHHLSQYHP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |