Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0566900_circ_g.1 |
ID in PlantcircBase | osa_circ_002252 |
Alias | Os_ciR5837 |
Organism | Oryza sativa |
Position | chr1: 21700702-21702118 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os01g0566900 |
Parent gene annotation |
Similar to 3'-5' exonuclease domain-containing protein-like. (Os 01t0566900-01) |
Parent gene strand | - |
Alternative splicing | Os01g0566900_circ_g.2 Os01g0566900_circ_g.3 |
Support reads | 2/2 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0566900-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.133498195 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
21701138-21702068(-) 21700748-21702068(-) |
Potential amino acid sequence |
MAYPEKEEVRTLLRQDPNFWTHRPLSEMMIRAATDDVRFLLSIHEKMMEKLSKVSLWRLSVRSE LYCRCFCINDNKYADWPPLPTVPDRLFSVRGAGREKERIR*(-) MTTSMRIGHLFQLSLIAYSLLEEQEGKKRGYDEYISFVSLLADPRYCGMAYPEKEEVRTLLRQD PNFWTHRPLSEMMIRAATDDVRFLLSIHEKMMEKLSKVSLWRLSVRSELYCRCFCINDNKYADW PPLPTVPDRLFSVRGAGREKERIR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |