Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G53570_circ_g.1 |
ID in PlantcircBase | ath_circ_007180 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 19989143-19989465 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | KNIFE, PcircRNA_finder |
Parent gene | AT1G53570 |
Parent gene annotation |
Mitogen-activated protein kinase kinase kinase 3 |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 14 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G53570.4:2 AT1G53570.3:2 AT1G53570.5:2 AT1G53570.1:2 AT1G53570.7:2 AT1G53570.2:2 AT1G53570.6:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.29542873 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
19989454-19989462(+) |
Potential amino acid sequence |
MAKHSEETLSVYLEYVSGGSIHKLLKDYGSFTEPVIQNYTRQILAGLAYLHGRNTVHRDIKGAN ILVDPNGEIKLADFGMAKHSEETLSVYLEYVSGGSIHKLLKDYGSFTEPVIQNYTRQILAGLAY LHGRNTVHRDIKGANILVDPNGEIKLADFGMAKHSEETLSVYLEYVSGGSIHKLLKDYGSFTEP VIQNYTRQILAGLAYLHGRNTVHRDIKGANILVDPNGEIKLADFGMAKH(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |