Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G53570_circ_g.1 |
| ID in PlantcircBase | ath_circ_007180 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 19989143-19989465 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | KNIFE, PcircRNA_finder |
| Parent gene | AT1G53570 |
| Parent gene annotation |
Mitogen-activated protein kinase kinase kinase 3 |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 14 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT1G53570.4:2 AT1G53570.3:2 AT1G53570.5:2 AT1G53570.1:2 AT1G53570.7:2 AT1G53570.2:2 AT1G53570.6:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.29542873 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19989454-19989462(+) |
| Potential amino acid sequence |
MAKHSEETLSVYLEYVSGGSIHKLLKDYGSFTEPVIQNYTRQILAGLAYLHGRNTVHRDIKGAN ILVDPNGEIKLADFGMAKHSEETLSVYLEYVSGGSIHKLLKDYGSFTEPVIQNYTRQILAGLAY LHGRNTVHRDIKGANILVDPNGEIKLADFGMAKHSEETLSVYLEYVSGGSIHKLLKDYGSFTEP VIQNYTRQILAGLAYLHGRNTVHRDIKGANILVDPNGEIKLADFGMAKH(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |