Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT5G50340_circ_g.1 |
ID in PlantcircBase | ath_circ_043401 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr5: 20493203-20493695 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT5G50340 |
Parent gene annotation |
ATP-dependent peptidases;nucleotide binding;serine-type endopept idases;DNA helicases;ATP binding;damaged DNA binding;nucleoside- triphosphatases |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT5G50340.1:3 AT5G50340.2:3 AT5G50340.3:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.173703804 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
20493489-20493692(+) |
Potential amino acid sequence |
MCSKTRGPAISPAFVTCPTKKTGILDFLAKRNRVDVHSLTSSVDPNRFFTDRSKRYVDDSSPSK YKTTSTMCSKTRGPAISPAFVTCPTKKTGILDFLAKRNRVDVHSLTSSVDPNRFFTDRSKRYVD DSSPSKYKTTSTMCSKTRGPAISPAFVTCPTKKTGILDFLAKRNRVDVHSLTSSVDPNRFFTDR SKRYVDDSSPSKYKTTSTMCSKTRGPAISPAFVTCPTKKTGILDFLAKRNRVDVHSL(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |