Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0526700_circ_g.7 |
| ID in PlantcircBase | osa_circ_037785 |
| Alias | Os_ciR1713 |
| Organism | Oryza sativa |
| Position | chr8: 26218001-26218224 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, find_circ |
| Parent gene | Os08g0526700 |
| Parent gene annotation |
Similar to UBA/UBX 33.3 kDa protein. (Os08t0526700-00) |
| Parent gene strand | + |
| Alternative splicing | Os08g0526700_circ_g.6 |
| Support reads | 12/4 |
| Tissues | root/shoot, root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0526700-00:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_018094 |
| PMCS | 0.365191915 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26218032-26218221(+) |
| Potential amino acid sequence |
MENPVASVPTLTPTKIKPVEPAVSPEQLRDCLRNLKKNYKAERRRRLGLPMENPVASVPTLTPT KIKPVEPAVSPEQLRDCLRNLKKNYKAERRRRLGLPMENPVASVPTLTPTKIKPVEPAVSPEQL RDCLRNLKKNYKAERRRRLGLPMENPVASVPTLTPTKIKPVEPAVSPEQLRDCLRNLKKNYK(+ ) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |