Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0526700_circ_g.7 |
ID in PlantcircBase | osa_circ_037785 |
Alias | Os_ciR1713 |
Organism | Oryza sativa |
Position | chr8: 26218001-26218224 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder, find_circ |
Parent gene | Os08g0526700 |
Parent gene annotation |
Similar to UBA/UBX 33.3 kDa protein. (Os08t0526700-00) |
Parent gene strand | + |
Alternative splicing | Os08g0526700_circ_g.6 |
Support reads | 12/4 |
Tissues | root/shoot, root, seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os08t0526700-00:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_018094 |
PMCS | 0.365191915 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
26218032-26218221(+) |
Potential amino acid sequence |
MENPVASVPTLTPTKIKPVEPAVSPEQLRDCLRNLKKNYKAERRRRLGLPMENPVASVPTLTPT KIKPVEPAVSPEQLRDCLRNLKKNYKAERRRRLGLPMENPVASVPTLTPTKIKPVEPAVSPEQL RDCLRNLKKNYKAERRRRLGLPMENPVASVPTLTPTKIKPVEPAVSPEQLRDCLRNLKKNYK(+ ) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |