Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.008G195800_circ_g.1 |
| ID in PlantcircBase | gra_circ_000860 |
| Alias | Chr08:48065479|48065920 |
| Organism | Gossypium raimondii |
| Position | chrChr08: 48065479-48065920 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.008G195800 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.008G195800.2:3 Gorai.008G195800.3:2 Gorai.008G195800.5:1 Gorai.008G195800.4:3 Gorai.008G195800.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.650295569 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
48065774-48065774(+) |
| Potential amino acid sequence |
MKCAIISYITVVGRWNNIFQFLASEDVDSDKVTLSMTMLPSLGGGNFNNLFQQVVISWKPQIIF GVSTVSQQTHKSVLRNVNQLVISTIDMWNRL*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |