Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0640000_circ_g.1 |
| ID in PlantcircBase | osa_circ_015748 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 25685015-25685857 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0640000 |
| Parent gene annotation |
C2 calcium-dependent membrane targeting domain containing protei n. (Os02t0640000-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0640000-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_012050 |
| PMCS | 0.155397835 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25685809-25685482(+) 25685021-25685071(+) 25685074-25685849(-) 25685031-25685573(-) |
| Potential amino acid sequence |
MNITVEKSKSASHSLLRQHGSICNSQVPFTGAEKQHSIRQRK*(+) MDPYAILKCRSQEQRSSIASGKGSNPEWNENFVFTVSDKATELLIKLLDSDTGSADDFVGEATI PLEAVYTEGSIPPTLYNVVKDEHYCGEIKVGLTFTPEATWIHMQFSSAVHRSREAA*(+) MLLLCSCERHLRIAYGSMLPQE*(-) MDPCCLRSECEADFDFSTVMFILHNIIQSWWNTPFSIHCFQRNRCFTNKVVG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |