Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G34250_circ_g.6 |
ID in PlantcircBase | ath_circ_016388 |
Alias | At_ciR2835 |
Organism | Arabidpsis thaliana |
Position | chr2: 14463891-14464247 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | find_circ, CIRI-full |
Parent gene | AT2G34250 |
Parent gene annotation |
AT2G34250 protein |
Parent gene strand | + |
Alternative splicing | AT2G34250_circ_g.1 AT2G34250_circ_g.2 AT2G34250_circ_g.3 AT2G34250_circ_g.4 AT2G34250_circ_g.5 |
Support reads | 3 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT2G34250.3:2 AT2G34250.2:2 AT2G34250.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.33452866 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
14464122-14464244(+) |
Potential amino acid sequence |
MAAHPFHALFYIVFMLTACALFSKTWIEVSGSSARDVAKQLKLLYRKFSGNFFVNLLGQWKESE YSGQSIPVSGLAYLITAPASFSDMAAHPFHALFYIVFMLTACALFSKTWIEVSGSSARDVAKQL KLLYRKFSGNFFVNLLGQWKESEYSGQSIPVSGLAYLITAPASFSDMAAHPFHALFYIVFMLTA CALFSKTWIEVSGSSARDVAKQLKLLYRKFSGNFFVNLLGQWKESEYSGQSIPVSGLAYLITAP ASFSDMAAHPFHALFYIVFMLTACALFSKTWIEVSGSSARDVAKQLK(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |