Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G05380_circ_g.1 |
| ID in PlantcircBase | ath_circ_012847 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr2: 1966816-1966923 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | ue-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT2G05380 |
| Parent gene annotation |
glycine-rich protein 3 short isoform |
| Parent gene strand | + |
| Alternative splicing | AT2G05380_circ_g.2 |
| Support reads | 1 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-TT |
| Number of exons covered | AT2G05380.2:1 AT2G05380.3:1 AT2G05380.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.179089506 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1966851-1966920(+) |
| Potential amino acid sequence |
MASKTLLLLGLFAFLFIVSEMAAADSSQVLSSICKKMASKTLLLLGLFAFLFIVSEMAAADSSQ VLSSICKKMASKTLLLLGLFAFLFIVSEMAAADSSQVLSSICKKMASKTLLLLGLFAFLFIVSE MAAA(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |