Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G05380_circ_g.1 |
ID in PlantcircBase | ath_circ_012847 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr2: 1966816-1966923 JBrowse» |
Reference genome | TAIR10.38 |
Type | ue-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT2G05380 |
Parent gene annotation |
glycine-rich protein 3 short isoform |
Parent gene strand | + |
Alternative splicing | AT2G05380_circ_g.2 |
Support reads | 1 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | GT-TT |
Number of exons covered | AT2G05380.2:1 AT2G05380.3:1 AT2G05380.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.179089506 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
1966851-1966920(+) |
Potential amino acid sequence |
MASKTLLLLGLFAFLFIVSEMAAADSSQVLSSICKKMASKTLLLLGLFAFLFIVSEMAAADSSQ VLSSICKKMASKTLLLLGLFAFLFIVSEMAAADSSQVLSSICKKMASKTLLLLGLFAFLFIVSE MAAA(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |