Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.009G026200_circ_g.1 |
| ID in PlantcircBase | gra_circ_000916 |
| Alias | Chr09:2001335|2002519 |
| Organism | Gossypium raimondii |
| Position | chrChr09: 2001335-2002519 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.009G026200 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | orai.009G026200_circ_g.2 |
| Support reads | 4 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.009G026200.1:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000227 |
| PMCS | 0.136568312 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2001927-2002241(-) |
| Potential amino acid sequence |
MPELRRFAPNVPIVLVGTKLDLRDDRAYLADQMGSNIITSAQGEELRKQIGAAAYIECSSKTQQ NVKAVFDTAIKVVLQPPRRKEVARKKRRRRSGCSIMIIYQQCLTISVLMWLWMGALLIWVYGIL QVKRIIAG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |