Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G13060_circ_g.8 |
ID in PlantcircBase | ath_circ_002345 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 4454114-4454217 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | AT1G13060 |
Parent gene annotation |
20S proteasome beta subunit E1 |
Parent gene strand | + |
Alternative splicing | AT1G13060_circ_g.7 |
Support reads | 17 |
Tissues | root, leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G13060.2:1 AT1G13060.1:1 AT1G13060.3:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.308008654 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4454130-4454214(+) |
Potential amino acid sequence |
MSTTKEDGSRETGFQSVLVHHMLTVCWTAGSRTILCRQRRRTAQGRQVFSRFWFTICLRCAGQR GPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGVPDYTMSTTKEDGSRETGFQSVLVHHMLT VCWTA(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |