Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0645400_circ_g.11 |
| ID in PlantcircBase | osa_circ_031737 |
| Alias | Os_ciR4913 |
| Organism | Oryza sativa |
| Position | chr6: 26342484-26343804 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | find_circ |
| Parent gene | Os06g0645400 |
| Parent gene annotation |
Similar to Isoleucine-tRNA ligase-like protein. (Os06t0645400-01 );Similar to ATP binding protein (Fragment). (Os06t0645400-02) |
| Parent gene strand | + |
| Alternative splicing | Os06g0645400_circ_g.12 |
| Support reads | 4 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0645400-01:5 Os06t0645400-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.249943565 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26342489-26342504(+) 26342504-26343604(-) |
| Potential amino acid sequence |
MVIVHPDNEFLEDITGKLKEYVMEEMNVKTVTPCNDPMLYASLRAEPNFSVLGKRLGKDMGKVS NEVKKMTQEQILAFEQSGEISFFGHCLKLDDIKVIRQFKRPANVAENEIDAAGDGDVLVVLDLR ADQSLFEAGVAREGDGDCSS*(+) MNNHHLPLEQLQLQTMIDQLEDPKRLTHHHLPQHQFHSLPHLQDV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |