Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0645400_circ_g.11 |
ID in PlantcircBase | osa_circ_031737 |
Alias | Os_ciR4913 |
Organism | Oryza sativa |
Position | chr6: 26342484-26343804 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Os06g0645400 |
Parent gene annotation |
Similar to Isoleucine-tRNA ligase-like protein. (Os06t0645400-01 );Similar to ATP binding protein (Fragment). (Os06t0645400-02) |
Parent gene strand | + |
Alternative splicing | Os06g0645400_circ_g.12 |
Support reads | 4 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os06t0645400-01:5 Os06t0645400-02:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.249943565 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
26342489-26342504(+) 26342504-26343604(-) |
Potential amino acid sequence |
MVIVHPDNEFLEDITGKLKEYVMEEMNVKTVTPCNDPMLYASLRAEPNFSVLGKRLGKDMGKVS NEVKKMTQEQILAFEQSGEISFFGHCLKLDDIKVIRQFKRPANVAENEIDAAGDGDVLVVLDLR ADQSLFEAGVAREGDGDCSS*(+) MNNHHLPLEQLQLQTMIDQLEDPKRLTHHHLPQHQFHSLPHLQDV*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |