Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0476200_circ_g.1 |
| ID in PlantcircBase | osa_circ_028233 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 23420991-23421789 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0476200 |
| Parent gene annotation |
Similar to DNA replication licensing factor MCM3 homolog (Replic ation origin activator) (ROA protein) (Fragment). (Os05t0476200- 01);Similar to DNA replication licensing factor MCM3 homolog (Re plication origin activator) (ROA protein) (Fragment). (Os05t0476 200-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0476200-02:3 Os05t0476200-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.342465436 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23421028-23420992(+) |
| Potential amino acid sequence |
MCEYKDHQTLSMQEVPENSAPGQLPRTVDIIVEDDLVDSCKPGDRVSIVGVYKALPGKSKGSVS GVFRTVLIANNVSLMNKEANAPVYTREDLKRMKEISRRNDTFDLLGNSLAPSIYGHLWIKKAVV LLMLGGVEKNLKNGTHLRGDINMMMVGDPSVAKSQLLRAVMNIAPLAISTTGRGSSGVGLTAAV TSDQETG*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |