Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d007938_circ_g.1 |
ID in PlantcircBase | zma_circ_007451 |
Alias | Zm02circ00128 |
Organism | Zea mays |
Position | chr2: 243466455-243473259 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d007938 |
Parent gene annotation |
Suppressor of RPS4-RLD 1 |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d007938_T016:4 Zm00001d007938_T003:4 Zm00001d007938_T012:4 Zm00001d007938_T011:4 Zm00001d007938_T004:4 Zm00001d007938_T008:5 Zm00001d007938_T002:4 Zm00001d007938_T005:4 Zm00001d007938_T006:4 Zm00001d007938_T010:4 Zm00001d007938_T018:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.04640981 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
243473242-243466521(+) 243473247-243466521(+) 243466524-243473096(-) |
Potential amino acid sequence |
MEWVDIGIVNFKFKDYNSALEDLSTCVKHDKKNSSAHTYLGLTLSALGEYKRAEDEHVIGLKYD ESFLDCWAHLAQLYLDLAYPEKLLNCLEKAIQIDSRFAKAYHLRGILYHGMGRHRNCELQIQGL QLCTRRSFDMCEA*(+) MGRHRNCELQIQGLQLCTRRSFDMCEA*(+) MLHTCRKIFECRVVVLEFEVHNSYVDPFHGREFHADGKLLRTLNQFE*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020 |