Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G42780_circ_g.6 |
| ID in PlantcircBase | ath_circ_018015 |
| Alias | At_ciR3871 |
| Organism | Arabidpsis thaliana |
| Position | chr2: 17802272-17802391 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | KNIFE, find_circ, CIRI-full |
| Parent gene | AT2G42780 |
| Parent gene annotation |
At2g42780/F7D19.22 |
| Parent gene strand | + |
| Alternative splicing | AT2G42780_circ_g.1 AT2G42780_circ_g.2 AT2G42780_circ_g.3 AT2G42780_circ_g.4 AT2G42780_circ_g.5 |
| Support reads | 2/1 |
| Tissues | leaf/whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT2G42780.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.522222225 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17802337-17802388(+) |
| Potential amino acid sequence |
MVDEILLKLKRTRFRRVSVFLLQRKLAYLRIRLQLQEAFLMVDEILLKLKRTRFRRVSVFLLQR KLAYLRIRLQLQEAFLMVDEILLKLKRTRFRRVSVFLLQRKLAYLRIRLQLQEAFLMVDEILLK LKRTRFRRVS(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |