Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0724600_circ_g.1 |
ID in PlantcircBase | osa_circ_032410 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 30781831-30782560 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os06g0724600 |
Parent gene annotation |
Similar to Transformer-SR ribonucleoprotein (Fragment). (Os06t07 24600-01);Similar to transformer-2 protein. (Os06t0724600-02) |
Parent gene strand | + |
Alternative splicing | Os06g0724600_circ_g.2 Os06g0724600_circ_g.3 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os06t0724650-00:3 Os06t0724600-01:3 Os06t0724650-00:3 Os06t0724600-02:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.164274623 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
30782478-30781911(+) |
Potential amino acid sequence |
MDTVEDAERCIKYLNQSVMEGRNITVEKVLRVPLSLQGKPKIKVKITITCCSIPV*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |