Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT3G54380_circ_g.1 |
ID in PlantcircBase | ath_circ_027453 |
Alias | At_ciR4941 |
Organism | Arabidpsis thaliana |
Position | chr3: 20134648-20134943 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | find_circ, circseq_cup, CIRI-full |
Parent gene | AT3G54380 |
Parent gene annotation |
SAC3 family protein C |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 2 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT3G54380.3:2 AT3G54380.1:2 AT3G54380.2:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.265315839 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
20134735-20134650(-) |
Potential amino acid sequence |
MGNYKNFLSRTASEATYLQYCISEHHIREGEPLSLWFRKLTFALVKSKEICFVRNLLRLYRMGN YKNFLSRTASEATYLQYCISEHHIREGEPLSLWFRKLTFALVKSKEICFVRNLLRLYRMGNYKN FLSRTASEATYLQYCISEHHIREGEPLSLWFRKLTFALVKSKEICFVRNLLRLYRMGNYKNFLS RTASEATYLQYCISEHHIRE(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |