Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0150700_circ_g.2 |
ID in PlantcircBase | osa_circ_032785 |
Alias | NA |
Organism | Oryza sativa |
Position | chr7: 2644772-2644891 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os07g0150700 |
Parent gene annotation |
Serine/threonine protein kinase, Pollination and drought stress responses, Reguration of potassium uptake by CBL1-CIPK23 complex (Os07t0150700-01) |
Parent gene strand | - |
Alternative splicing | Os07g0150700_circ_g.3 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os07t0150700-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.284718264 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2644882-2644838(+) 2644865-2644774(-) |
Potential amino acid sequence |
MVILPDSLKIELISSRLTSAVSNLGG*(+) MSGSRRDISLQGLRQQMLTWMISTLFLMNLGGLPSQSLSTMSGSRRDISLQGLRQQMLTWMIST LFLMNLGGLPSQSLSTMSGSRRDISLQGLRQQMLTWMISTLFLMNLGGLPSQSLSTMSGSRRDI SLQGLRQQMLTWMISTLFLMNL(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |