Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d045340_circ_g.1 |
ID in PlantcircBase | zma_circ_009866 |
Alias | Zm09circ00011 |
Organism | Zea mays |
Position | chr9: 19217022-19217771 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d045340 |
Parent gene annotation |
Pyridoxal-5'-phosphate-dependent enzyme family protein |
Parent gene strand | - |
Alternative splicing | Zm00001d045340_circ_ag.1 |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d045340_T006:1 Zm00001d045340_T002:1 Zm00001d045340_T007:3 Zm00001d045340_T005:1 Zm00001d045340_T003:2 Zm00001d045340_T004:3 Zm00001d045340_T008:1 Zm00001d045340_T009:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.126444067 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
19217695-19217057(+) 19217500-19217769(-) |
Potential amino acid sequence |
MLPLVGSTSVVTPGEINPLSSASSIILKSLGFLQAQRR*(+) MMGGLLPSGSTVCADPALGFPGMFDKVEQLRKQLPNVHVLNQVTNKANSEAHFRLTGPEIWKDT AGKVDVFVAGSGTGGTVSGVGKYLKMQKPGVKIICVEPAESPVISE*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020 |