Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G12840_circ_g.2 |
| ID in PlantcircBase | ath_circ_037827 |
| Alias | At_ciR3237, Ath_circ_FC2105 |
| Organism | Arabidpsis thaliana |
| Position | chr5: 4051532-4052079 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | AT5G12840 |
| Parent gene annotation |
Nuclear transcription factor Y subunit A-1 |
| Parent gene strand | - |
| Alternative splicing | AT5G12840_circ_g.3 AT5G12840_circ_g.4 AT5G12840_circ_g.5 AT5G12840_circ_g.6 |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT5G12840.2:2 AT5G12840.4:2 AT5G12840.5:2 AT5G12840.3:2 AT5G12840.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.147460858 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4052035-4051534(-) |
| Potential amino acid sequence |
MGAYGHQQLGFRPYLGMPRERTALPLDMAQEPVYVNAKQYEGILRRRKARAKAELERKVIRDRK ACVPNPYQDPYYGGLMGAYGHQQLGFRPYLGMPRERTALPLDMAQEPVYVNAKQYEGILRRRKA RAKAELERKVIRDRKACVPNPYQDPYYGGLMGAYGHQQLGFRPYLGMPRERTALPLDMAQEPVY VNAKQYEGILRRRKARAKAELERKVIRDRKACVPNPYQDPYYGGLMGAYGHQQLGFRPYLGMPR ERTALPLDMAQEPVYVNAKQYEGILRRRKARAKAELERKVIRDRK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chen et al., 2017a |