Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G07220_circ_g.1 |
| ID in PlantcircBase | ath_circ_036838 |
| Alias | At_ciR5834 |
| Organism | Arabidpsis thaliana |
| Position | chr5: 2265940-2266086 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, find_circ |
| Parent gene | AT5G07220 |
| Parent gene annotation |
BAG family molecular chaperone regulator 3 |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2/1 |
| Tissues | leaf/root, leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT5G07220.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.406218876 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2266015-2265942(-) |
| Potential amino acid sequence |
MLMNQLLRLDAIIADGDVKLMRKMQVSAFETVINKGGKVEEKSLVNLIEMLMNQLLRLDAIIAD GDVKLMRKMQVSAFETVINKGGKVEEKSLVNLIEMLMNQLLRLDAIIADGDVKLMRKMQVSAFE TVINKGGKVEEKSLVNLIEMLMNQLLRLDAIIADGDVKLMRKMQ(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |