Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os11g0655800_circ_g.1 |
ID in PlantcircBase | osa_circ_009900 |
Alias | NA |
Organism | Oryza sativa |
Position | chr11: 26264684-26265512 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os11g0655800 |
Parent gene annotation |
Lipase, class 3 family protein. (Os11t0655800-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os11t0655800-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.120262877 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
26265324-26264702(+) 26264693-26264702(+) 26264741-26265493(-) |
Potential amino acid sequence |
MWRTAYRLLLESPLIHNPYSLLLEAHKNTELRMKHSDGGYSYNRTLAHIFVQYASAVYTSDLTS LFAWTCPRCQSDTKGFEMIEIIVDVENCLQAFVGVAPDPQSILIAFRGTQEHRTQDEAF*(+) MKHSDGGYSYNRTLAHIFVQYASAVYTSDLTSLFAWTCPRCQSDTKGFEMIEIIVDVENCLQAF VGVAPDPQSILIAFRGTQEHRTQDEAF*(+) MGESAVIRIATIRMLHPEFCVLVCL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |