Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0605300_circ_g.1 |
ID in PlantcircBase | osa_circ_025101 |
Alias | Os04circ12857/Os_ciR9540 |
Organism | Oryza sativa |
Position | chr4: 30555858-30556903 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, SMALT, Segemehl, find_circ |
Parent gene | Os04g0605300 |
Parent gene annotation |
Leucine-rich repeat, typical subtype containing protein. (Os04t0 605300-01);Leucine-rich repeat, typical subtype containing prote in. (Os04t0605300-02) |
Parent gene strand | - |
Alternative splicing | Os04g0605300_circ_g.2 Os04g0605300_circ_g.3 Os04g0605300_circ_g.4 |
Support reads | 2/2/3 |
Tissues | leaf/root/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os04t0605300-02:2 Os04t0605300-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_005700* |
PMCS | 0.263011608 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
30556871-30556012(+) 30556873-30556833(-) |
Potential amino acid sequence |
MLPIFFSTSDIPALLDGVGEGLEQVAGDVEDLELGEAADGVGQRFQLVGPHVQHHHVQQPSDY* (+) MREMGEKRRRGHLNPAGFAGGLHDHEEKKNEEHKLDMSGMSMDALPHLTMSLGQVTILDLSNNN LESIPESIIARLLNVVVLDVRSNQLKSLPNSIGCLSKLKVLNVSGNLLESLPNTIEECRYIRSG EEDWKHEGNGREEEAWTP*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |