Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0605300_circ_g.1 |
| ID in PlantcircBase | osa_circ_025101 |
| Alias | Os04circ12857/Os_ciR9540 |
| Organism | Oryza sativa |
| Position | chr4: 30555858-30556903 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl, find_circ |
| Parent gene | Os04g0605300 |
| Parent gene annotation |
Leucine-rich repeat, typical subtype containing protein. (Os04t0 605300-01);Leucine-rich repeat, typical subtype containing prote in. (Os04t0605300-02) |
| Parent gene strand | - |
| Alternative splicing | Os04g0605300_circ_g.2 Os04g0605300_circ_g.3 Os04g0605300_circ_g.4 |
| Support reads | 2/2/3 |
| Tissues | leaf/root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0605300-02:2 Os04t0605300-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_005700* |
| PMCS | 0.263011608 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30556871-30556012(+) 30556873-30556833(-) |
| Potential amino acid sequence |
MLPIFFSTSDIPALLDGVGEGLEQVAGDVEDLELGEAADGVGQRFQLVGPHVQHHHVQQPSDY* (+) MREMGEKRRRGHLNPAGFAGGLHDHEEKKNEEHKLDMSGMSMDALPHLTMSLGQVTILDLSNNN LESIPESIIARLLNVVVLDVRSNQLKSLPNSIGCLSKLKVLNVSGNLLESLPNTIEECRYIRSG EEDWKHEGNGREEEAWTP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |