Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0437800_circ_g.7 |
| ID in PlantcircBase | osa_circ_014550 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 13985134-13985543 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0437800 |
| Parent gene annotation |
Similar to vacuolar protein-sorting protein 45. (Os02t0437800-01 );Similar to Vacuolar protein-sorting protein 45 homolog (AtVPS4 5). (Os02t0437800-02);Similar to vacuolar protein-sorting protei n 45. (Os02t0437800-03) |
| Parent gene strand | - |
| Alternative splicing | Os02g0437800_circ_g.8 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0437800-02:2 Os02t0437800-03:2 Os02t0437800-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.306543089 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13985324-13985290(+) 13985233-13985491(-) 13985291-13985528(-) |
| Potential amino acid sequence |
MVRVDGTKISIELLNLLHNLLLIGICEHLNLWNLQYIGEDAVSCAILFATSDVLWYLITGRRLR ARKTEAMPSTARSQKLCIPGGSTTIGSM*(+) MALLLSSWLSSAVLLLDTKGHLMLQKGLHKKLRLLQCIEDSTDSGARRFR*(-) MLPMVVDPPGMQSFCDRAVDGIASVFLALKRRPVIRYQRTSDVAKRIAQETASSPMY*(-) |
| Sponge-miRNAs | osa-miR5144-3p |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |