Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0203700_circ_g.1 |
| ID in PlantcircBase | osa_circ_033149 |
| Alias | Os_ciR11284 |
| Organism | Oryza sativa |
| Position | chr7: 5570707-5571589 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, find_circ |
| Parent gene | Os07g0203700 |
| Parent gene annotation |
Cleavage and polyadenylation specificity factor, A subunit, C-te rminal domain containing protein. (Os07t0203700-01) |
| Parent gene strand | - |
| Alternative splicing | Os07g0203700_circ_g.2 |
| Support reads | 2/1 |
| Tissues | root/shoot, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0203700-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.174582012 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5570738-5570709(-) |
| Potential amino acid sequence |
MGETAMSIQKLFVFGFLNESPHRIKKYTTSRTRFTITCLKTYASRIAVGDCRDGVLFYSYHENL RKLELIYSDPAQRLVGDVALLSCETAVVSDRRGSISVLSCPRLEVSESPEKNLAVHCSFYMGET AMSIQKLFVFGFLNESPHRIKKYTTSRTRFTITCLKTYASRIAVGDCRDGVLFYSYHENLRKLE LIYSDPAQRLVGDVALLSCETAVVSDRRGSISVLSCPRLEVSESPEKNLAVHCSFYMGETAMSI QKLFVFGFLNESPHRIKKYTTSRTRFTITCLKTYASRIAVGDCRDGVLFYSYHENLRKLELIYS DPAQRLVGDVALLSCETAVVSDRRGSISVLSCPRLEVSESPEKNLAVHCSFYMGETAMSIQK(- ) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |