Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G30610_circ_g.3 |
ID in PlantcircBase | ath_circ_005109 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 10848200-10848391 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | AT1G30610 |
Parent gene annotation |
Pentatricopeptide repeat-containing protein At1g30610, chloropla stic |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G30610.1:1 AT1G30610.2:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.189234722 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
10848222-10848388(+) |
Potential amino acid sequence |
MPEWQFSKAIRSAKIRYTDYTVMRLIHFLGKLGNWRRVLQVIEWLQRQDRYKSNKIRLNGADIN MPEWQFSKAIRSAKIRYTDYTVMRLIHFLGKLGNWRRVLQVIEWLQRQDRYKSNKIRLNGADIN MPEWQFSKAIRSAKIRYTDYTVMRLIHFLGKLGNWRRVLQVIEWLQRQDRYKSNKIRLNGADIN MPEWQFSKAIRSAKIRYTDYTVMRLIHFLGKLGNWRRVLQVIEWLQRQDRYKSNKI(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |