Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d044358_circ_g.5 |
ID in PlantcircBase | zma_circ_007894 |
Alias | Zm03circ00129 |
Organism | Zea mays |
Position | chr3: 225848329-225857757 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d044358 |
Parent gene annotation |
Regulator of telomere elongation helicase 1 |
Parent gene strand | - |
Alternative splicing | Zm00001d044358_circ_g.1 Zm00001d044358_circ_g.2 Zm00001d044358_circ_g.3 Zm00001d044358_circ_g.4 Zm00001d044358_circ_g.6 Zm00001d044358_circ_g.7 |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d044358_T004:9 Zm00001d044358_T001:11 Zm00001d044358_T003:11 Zm00001d044358_T011:10 Zm00001d044358_T002:11 Zm00001d044358_T008:10 Zm00001d044358_T010:9 Zm00001d044358_T007:11 Zm00001d044358_T013:6 Zm00001d044358_T006:11 Zm00001d044358_T005:9 Zm00001d044358_T009:10 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.027609684 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
225857729-225849099(+) 225857719-225848423(+) 225849725-225851946(-) |
Potential amino acid sequence |
MCLLRFVHMKYYNLLALVSKDLKKLYLEKIGSILGLLPHTLSSTLYEVGANMTSEIDNLATQTF HHNK*(+) MHLHVFVEIRSHEILQSVGSSVKGSEEALSRKNRVNPWTTSPYFE*(+) MPFATPTDAKVRLKREYLDKQGTPSNKNTKMLTGEEWYVQQAARAVNQAVGRVIRHRHDYGAII YCDERFVWPNYQSQMSYWLRPHIKCYSKYGEVVQGLTRFFRDKASSDPLTLEPTDCNISCERIS TNTWRCIEIFG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020 |