Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0565400_circ_g.1 |
ID in PlantcircBase | osa_circ_034331 |
Alias | Os_ciR11021 |
Organism | Oryza sativa |
Position | chr7: 22672191-22672347 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os07g0565400 |
Parent gene annotation |
Similar to SRF8 (STRUBBELIG-RECEPTOR FAMILY 8). (Os07t0565400-01 ) |
Parent gene strand | - |
Alternative splicing | Os07g0565400_circ_igg.1 Os07g0565400_circ_igg.2 Os07g0565400_circ_ig.1 Os07g0565400_circ_ig.2 Os07g0565400_circ_ig.3 Os07g0565400_circ_ig.4 Os07g0565400_circ_ig.5 Os07g0565400_circ_ig.6 |
Support reads | 2/1 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os07t0565400-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.23672983 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
22672273-22672332(-) |
Potential amino acid sequence |
MVDPSIRGQCSEKALSRFVDIISSCIQFTSTC*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |