Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0565400_circ_g.1 |
| ID in PlantcircBase | osa_circ_034331 |
| Alias | Os_ciR11021 |
| Organism | Oryza sativa |
| Position | chr7: 22672191-22672347 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os07g0565400 |
| Parent gene annotation |
Similar to SRF8 (STRUBBELIG-RECEPTOR FAMILY 8). (Os07t0565400-01 ) |
| Parent gene strand | - |
| Alternative splicing | Os07g0565400_circ_igg.1 Os07g0565400_circ_igg.2 Os07g0565400_circ_ig.1 Os07g0565400_circ_ig.2 Os07g0565400_circ_ig.3 Os07g0565400_circ_ig.4 Os07g0565400_circ_ig.5 Os07g0565400_circ_ig.6 |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0565400-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.23672983 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22672273-22672332(-) |
| Potential amino acid sequence |
MVDPSIRGQCSEKALSRFVDIISSCIQFTSTC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |