Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0493500_circ_g.2 |
ID in PlantcircBase | osa_circ_028342 |
Alias | Os_ciR5475 |
Organism | Oryza sativa |
Position | chr5: 24241790-24242233 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Os05g0493400 |
Parent gene annotation |
Similar to Cyclin box (Fragment). (Os05t0493400-01) |
Parent gene strand | - |
Alternative splicing | Os05g0493500_circ_g.1 |
Support reads | 3 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os05t0493500-00:2 Os05t0493400-01:1 Os05t0493500-00:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.239219482 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
24242210-24242220(-) |
Potential amino acid sequence |
MSSMYSTTASWLSPSSLSMSSTTSFGFSVMPHACLERAVSTDVSVFTTFFLEYLRAEPPLLLPA PSDSDGFLFSLTPAPVLALAAFSGRGTTFFAGFGAGSFLAGFCTTIWAVL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |