Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT4G07855_circ_g.4 |
ID in PlantcircBase | ath_circ_033134 |
Alias | At_ciR2719 |
Organism | Arabidpsis thaliana |
Position | chr4: 13744070-13744261 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder, find_circ, CIRI-full |
Parent gene | AT4G27500 |
Parent gene annotation |
Proton pump-interactor 1 |
Parent gene strand | + |
Alternative splicing | AT4G07855_circ_g.1 AT4G07855_circ_g.2 AT4G07855_circ_g.3 AT4G07855_circ_g.5 |
Support reads | 3/28 |
Tissues | leaf/leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT4G27500.2:1 AT4G27500.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.26823967 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
13744136-13744258(+) |
Potential amino acid sequence |
MFDEKRKEMEPLQQALGKLRSNDGGSARGPAICSSEEELNSMAERSELFDLLDPLKSERKGFNT MFDEKRKEMEPLQQALGKLRSNDGGSARGPAICSSEEELNSMAERSELFDLLDPLKSERKGFNT MFDEKRKEMEPLQQALGKLRSNDGGSARGPAICSSEEELNSMAERSELFDLLDPLKSERKGFNT MFDEKRKEMEPLQQALGKLRSNDGGSARGPAICSSEEELNSM(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |