Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G07855_circ_g.4 |
| ID in PlantcircBase | ath_circ_033134 |
| Alias | At_ciR2719 |
| Organism | Arabidpsis thaliana |
| Position | chr4: 13744070-13744261 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder, find_circ, CIRI-full |
| Parent gene | AT4G27500 |
| Parent gene annotation |
Proton pump-interactor 1 |
| Parent gene strand | + |
| Alternative splicing | AT4G07855_circ_g.1 AT4G07855_circ_g.2 AT4G07855_circ_g.3 AT4G07855_circ_g.5 |
| Support reads | 3/28 |
| Tissues | leaf/leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT4G27500.2:1 AT4G27500.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.26823967 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13744136-13744258(+) |
| Potential amino acid sequence |
MFDEKRKEMEPLQQALGKLRSNDGGSARGPAICSSEEELNSMAERSELFDLLDPLKSERKGFNT MFDEKRKEMEPLQQALGKLRSNDGGSARGPAICSSEEELNSMAERSELFDLLDPLKSERKGFNT MFDEKRKEMEPLQQALGKLRSNDGGSARGPAICSSEEELNSMAERSELFDLLDPLKSERKGFNT MFDEKRKEMEPLQQALGKLRSNDGGSARGPAICSSEEELNSM(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |