Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G01950_circ_g.12 |
| ID in PlantcircBase | ath_circ_000166 |
| Alias | AT1G01950_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 329781-329924 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | KNIFE, PcircRNA_finder, circRNA_finder, CIRI-full, CIRI2 |
| Parent gene | AT1G01950 |
| Parent gene annotation |
Kinesin-like protein |
| Parent gene strand | + |
| Alternative splicing | AT1G01950_circ_g.13 |
| Support reads | 3 |
| Tissues | whole_plant, leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT1G01950.2:1 AT1G01950.4:1 AT1G01950.3:1 AT1G01950.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.501022934 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
329834-329921(+) |
| Potential amino acid sequence |
MVRCGHPDVLAQVARGIANFAKCESRATTQDKLQARLWSDGGIKALLGMVRCGHPDVLAQVARG IANFAKCESRATTQDKLQARLWSDGGIKALLGMVRCGHPDVLAQVARGIANFAKCESRATTQDK LQARLWSDGGIKALLGMVRCGHPDVLAQVARGIANFAKCESRATTQ(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Zhang et al., 2019 |