Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0748600_circ_g.2 |
| ID in PlantcircBase | osa_circ_003867 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 31334066-31334963 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0748600 |
| Parent gene annotation |
Similar to Protein kinase family protein. (Os01t0748600-01);Seri ne/threonine protein kinase-related domain containing protein. ( Os01t0748600-02) |
| Parent gene strand | - |
| Alternative splicing | Os01g0748600_circ_g.3 Os01g0748600_circ_g.4 Os01g0748600_circ_g.5 Os01g0748600_circ_g.6 Os01g0748600_circ_g.7 Os01g0748600_circ_g.8 Os01g0748600_circ_g.9 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0748600-02:5 Os01t0748600-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.198150993 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
31334916-31334335(+) 31334793-31334944(-) |
| Potential amino acid sequence |
MTVPEPLSYSSACANHLSQSVSIMLWRSSERWPFFRIMCLLNFIIFLVIKRETSFNHLLKYQSK *(+) MNYLHEHKPQAIIHRDLEPSNILRDDTGHLKVADFDLCKMLKWRRKVREEKAVTSPGNACRYVA PEVLRNEEYDTKVDVFSFALILQEMIEGCLPFYDKKNNEIEKAHNSKERPPFRAPPKHYAYGLR EVICAST*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |