Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G37220_circ_g.10 |
ID in PlantcircBase | ath_circ_017024 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr2: 15635753-15635854 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT2G37220 |
Parent gene annotation |
RNA-binding protein CP29B, chloroplastic |
Parent gene strand | - |
Alternative splicing | AT2G37220_circ_g.1 AT2G37220_circ_g.2 AT2G37220_circ_g.3 AT2G37220_circ_g.4 AT2G37220_circ_g.5 AT2G37220_circ_g.6 AT2G37220_circ_g.7 AT2G37220_circ_g.8 AT2G37220_circ_g.9 AT2G37220_circ_g.11 |
Support reads | 26 |
Tissues | aerial, whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT2G37220.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.320268138 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
15635804-15635755(-) |
Potential amino acid sequence |
MSSVSEVEAAAQQFNGYVIYDKITGRSRGFGFVTMSSVSEVEAAAQQFNGYVIYDKITGRSRGF GFVTMSSVSEVEAAAQQFNGYVIYDKITGRSRGFGFVTMSSVSEVEAAAQQFNGY(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |