Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc05g055040.2_circ_g.2 |
| ID in PlantcircBase | sly_circ_001829 |
| Alias | 5:63962802|63963273 |
| Organism | Solanum lycopersicum |
| Position | chr5: 64816452-64816923 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Solyc05g055040.2 |
| Parent gene annotation |
Hexosyltransferase |
| Parent gene strand | + |
| Alternative splicing | Solyc05g055040.2_circ_g.1 |
| Support reads | 9/18 |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Solyc05g055040.2.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.795150142 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
64816555-64816533(+) 64816469-64816876(-) |
| Potential amino acid sequence |
MPWTGLFLMYEWTFTLFFLQFGSYLYLVYQWGKAVANRAGQSRANSTSLDHESGKGHQRQQSCC DIAACYYGLGMAFLAILAPALPSIFGITALFLSQRCLHFWVGYLYVSVLLLFWCLLGFHL*(+) MQAPLAQKQSSDSENTRQCGG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to chilling stress; fruit ripening |
| Other Information | |
|---|---|
| References | Zuo et al., 2016; Yin et al., 2018 |