Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0821800_circ_g.3 |
ID in PlantcircBase | osa_circ_004649 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 35070388-35071473 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0821800 |
Parent gene annotation |
Nucleic acid-binding, OB-fold-like domain containing protein. (O s01t0821800-01);Similar to methionyl-tRNA synthetase. (Os01t0821 800-02);Nucleic acid-binding, OB-fold-like domain containing pro tein. (Os01t0821800-03) |
Parent gene strand | - |
Alternative splicing | Os01g0821800_circ_g.1 Os01g0821800_circ_g.2 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0821800-01:4 Os01t0821800-03:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.197404926 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
35070894-35071304(-) |
Potential amino acid sequence |
MSAGLVLCASNQDHTVVEPLIPPEGAKPGERISFAGIKLLRIRQILLQQKITNLLGIKRKPRRN LQENQMRELRIKLHRKLQKRTQNAMSVS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |