Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0586800_circ_g.2 |
| ID in PlantcircBase | osa_circ_015201 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 22618541-22618706 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os02g0586800 |
| Parent gene annotation |
Tetratricopeptide-like helical domain containing protein. (Os02t 0586800-01) |
| Parent gene strand | + |
| Alternative splicing | Os02g0586800_circ_g.1 |
| Support reads | 3 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0586800-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.162192972 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22618587-22618554(+) 22618589-22618687(-) |
| Potential amino acid sequence |
MSILAVPLEASASAETCQPANSMANMPIFIAVALIGAAVGEMGTT*(+) MVEITAAFRRSGCAHFTNSSTY*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |