Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0586800_circ_g.2 |
ID in PlantcircBase | osa_circ_015201 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 22618541-22618706 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | Os02g0586800 |
Parent gene annotation |
Tetratricopeptide-like helical domain containing protein. (Os02t 0586800-01) |
Parent gene strand | + |
Alternative splicing | Os02g0586800_circ_g.1 |
Support reads | 3 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0586800-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.162192972 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
22618587-22618554(+) 22618589-22618687(-) |
Potential amino acid sequence |
MSILAVPLEASASAETCQPANSMANMPIFIAVALIGAAVGEMGTT*(+) MVEITAAFRRSGCAHFTNSSTY*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |