Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.008G136300_circ_g.1 |
| ID in PlantcircBase | gra_circ_000849 |
| Alias | Chr08:38529154|38530105 |
| Organism | Gossypium raimondii |
| Position | chrChr08: 38529154-38530105 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | u-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.008G136300 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 28/186 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.008G136300.7:4 Gorai.008G136300.2:4 Gorai.008G136300.6:4 Gorai.008G136300.1:4 Gorai.008G136300.3:4 Gorai.008G136300.10:4 Gorai.008G136300.8:4 Gorai.008G136300.4:3 Gorai.008G136300.5:4 Gorai.008G136300.9:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs |
ghi_circ_000416* gar_circ_000736 ghi_circ_000194* ghi_circ_000195* |
| PMCS | 0.105129613 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
38529217-38529904(-) 38530098-38529724(+) |
| Potential amino acid sequence |
MGCMHTVNAVFLIVDTLFNSLVDICIGNGLLCAGDCHICLWMLGVLYYTTT*(-) MSTRLLKRVSTMRNTAFTVCMQPINCPKKENNHMFRPRCEFDKNGTITSQNTMSVKMTAPPHV* (+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |