Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Solyc12g021170.1_circ_g.1 |
ID in PlantcircBase | sly_circ_003585 |
Alias | 12:14513455|14517797 |
Organism | Solanum lycopersicum |
Position | chr12: 14513455-14517797 JBrowse» |
Reference genome | SL2.50.38 |
Type | e-circRNA |
Identification method | CIRI |
Parent gene | Solyc12g021170.1 |
Parent gene annotation |
Electron transfer flavoprotein-ubiquinone oxidoreductase, mitoch ondrial |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 3/6 |
Tissues | fruit |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Solyc12g021170.1.1:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.16790521 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
14513661-14513490(+) |
Potential amino acid sequence |
MGVAKDGSRKENYQHGVALKGRVTLLAEGCRGSLSEKLIKKYNLREKGQGQHQTYALGIKEFGS VGTLVGAES*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | fruit ripening |
Other Information | |
---|---|
References | Zuo et al., 2016; Yin et al., 2018 |