Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0308000_circ_g.6 |
| ID in PlantcircBase | osa_circ_030655 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 11681110-11681259 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0308000 |
| Parent gene annotation |
Similar to Trigger factor-like protein. (Os06t0308000-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0308000-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.313893667 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11681219-11681256(+) |
| Potential amino acid sequence |
MLAVGEIFKAENLQAERKLDKDQLASLSSQKSVQEYLESERENINRIIKQMLAVGEIFKAENLQ AERKLDKDQLASLSSQKSVQEYLESERENINRIIKQMLAVGEIFKAENLQAERKLDKDQLASLS SQKSVQEYLESERENINRIIKQMLAVGEIFKAENLQ(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |