Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0536000_circ_g.2 |
| ID in PlantcircBase | osa_circ_037849 |
| Alias | Os_ciR11586 |
| Organism | Oryza sativa |
| Position | chr8: 26779246-26779353 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os08g0536000 |
| Parent gene annotation |
Similar to Pyruvate dehydrogenase E1 beta subunit isoform 1 (EC 1.2.4.1). (Os08t0536000-01) |
| Parent gene strand | + |
| Alternative splicing | Os08g0536000_circ_g.3 Os08g0536000_circ_g.4 Os08g0536000_circ_g.5 Os08g0536000_circ_g.6 Os08g0536000_circ_g.7 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0536000-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.28703642 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26779247-26779350(+) |
| Potential amino acid sequence |
MTVREALNSALDEEMSADPSVFLMGEEVGEYQGAYKMTVREALNSALDEEMSADPSVFLMGEEV GEYQGAYKMTVREALNSALDEEMSADPSVFLMGEEVGEYQGAYKMTVREALNSALDEEMSADPS VFLMGEEVGEYQGAYK(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |