Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc03g117890.2_circ_g.1 |
| ID in PlantcircBase | sly_circ_001170 |
| Alias | NA |
| Organism | Solanum lycopersicum |
| Position | chr3: 66897941-66898771 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI; find_circ |
| Parent gene | Solyc03g117890.2 |
| Parent gene annotation |
protein_coding |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Solyc03g117890.2.1:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.192850481 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
66898575-66897982(+) 66898383-66898759(-) |
| Potential amino acid sequence |
MTLGVGTAVSWELPPSTAAVEDAFGIIVLSEKANLLTWLKSTKGFTHS*(+) MTALKNLGLNVVKANVYLDSSGKHNKLCITHASTGRKVEDPELLEAIRLTIINNLMEFHPESSS QLAMGEAFGAFQPSQKISFF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Yang et al., 2020 |