Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | orai.010G220200_circ_g.1 |
ID in PlantcircBase | gra_circ_001157 |
Alias | Chr10:58923081|58927468 |
Organism | Gossypium raimondii |
Position | chrChr10: 58923081-58927468 JBrowse» |
Reference genome | Graimondii_221 |
Type | e-circRNA |
Identification method | CIRI |
Parent gene | Gorai.010G220200 |
Parent gene annotation | NA |
Parent gene strand | + |
Alternative splicing | orai.010G220200_circ_g.2 orai.010G220200_circ_g.3 |
Support reads | 4/18 |
Tissues | leaf/ovule |
Exon boundary | Yes-Yes |
Splicing signals | AT-AC |
Number of exons covered | Gorai.010G220200.3:7 Gorai.010G220200.6:7 Gorai.010G220200.5:7 Gorai.010G220200.2:7 Gorai.010G220200.4:7 Gorai.010G220200.8:7 Gorai.010G220200.7:7 Gorai.010G220200.1:7 |
Conservation Information | |
---|---|
Conserved circRNAs | gar_circ_000924 |
PMCS | 0.098671426 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
58923390-58923092(+) |
Potential amino acid sequence |
MYLMYKLPFVECLMFGALISATDPVTVLSIFQELGTDMNLYALVFGESVLNDAMAISLYRTMSV VRSNDPSGQNFFMVIVRFLETFVGSMSAGVGVGFTSALSVRV*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Zhao et al., 2017b |