Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.010G220200_circ_g.1 |
| ID in PlantcircBase | gra_circ_001157 |
| Alias | Chr10:58923081|58927468 |
| Organism | Gossypium raimondii |
| Position | chrChr10: 58923081-58927468 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.010G220200 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | orai.010G220200_circ_g.2 orai.010G220200_circ_g.3 |
| Support reads | 4/18 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | AT-AC |
| Number of exons covered | Gorai.010G220200.3:7 Gorai.010G220200.6:7 Gorai.010G220200.5:7 Gorai.010G220200.2:7 Gorai.010G220200.4:7 Gorai.010G220200.8:7 Gorai.010G220200.7:7 Gorai.010G220200.1:7 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000924 |
| PMCS | 0.098671426 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
58923390-58923092(+) |
| Potential amino acid sequence |
MYLMYKLPFVECLMFGALISATDPVTVLSIFQELGTDMNLYALVFGESVLNDAMAISLYRTMSV VRSNDPSGQNFFMVIVRFLETFVGSMSAGVGVGFTSALSVRV*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |