Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0288400_circ_g.3 |
| ID in PlantcircBase | osa_circ_011147 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 11054283-11054579 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os12g0288400 |
| Parent gene annotation |
Similar to Ubiquitin ligase protein mib (EC 6.3.2.-) (Mind bomb protein). (Os12t0288400-01) |
| Parent gene strand | - |
| Alternative splicing | Os12g0288400_circ_g.2 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os12t0288400-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.332551487 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11054480-11054479(+) 11054353-11054359(-) |
| Potential amino acid sequence |
MRNNFSISGQSLLKTVAWSFVRIESEHILIVRRCCPSAIITNTWYWPPLCSTMVVAISIIGEND VGPERRR*(+) MATTIVEQSGGQYHVLVIIADGQHLRTIKMCSLSILTKDHATVFRRLWPDIEKLFLIFVFPVLH HSLQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |