Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0162550_circ_g.1 |
| ID in PlantcircBase | osa_circ_029774 |
| Alias | Os_ciR1333 |
| Organism | Oryza sativa |
| Position | chr6: 3149762-3150230 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os06g0162550 |
| Parent gene annotation |
Carotenoid oxygenase domain containing protein. (Os06t0162550-00 ) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 12 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0162550-00:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.252502132 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3150170-3149795(+) 3149843-3150229(-) 3149886-3150158(-) |
| Potential amino acid sequence |
MNEFSFLEFEIDLVKKPLTISSFPSSKQLNKW*(+) MLIPSSGLMWRIIAVTIYLIALRMEMS*(-) MGGISRIGVMPRFGDADSIIWFDVENHCSYHLFNCFEDGNELMVRGFFTRSISNSRKENSFMTS E*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |