Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0612600_circ_g.3 |
| ID in PlantcircBase | osa_circ_025199 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 31066284-31066702 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0612600 |
| Parent gene annotation |
Similar to Coatomer-like protein, epsilon subunit. (Os04t0612600 -01);Similar to Coatomer-like protein, epsilon subunit. (Os04t06 12600-02) |
| Parent gene strand | - |
| Alternative splicing | Os04g0612600_circ_g.1 Os04g0612600_circ_g.2 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0612600-01:2 Os04t0612600-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.418584149 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
31066700-31066408(+) 31066696-31066413(+) 31066673-31066675(-) |
| Potential amino acid sequence |
MPCSMLRVKESQPHQSSPCAYSKLPCHLEPFLSSGIFQQSLGI*(+) MHALFNASSKRVSASSKLPMCIQQTALPFRTIPVIGYFSAKSWNMR*(+) MHRSDYAEKQLKIMQQIDEDHTLTQLANAWLDIAVGGSKIREAYLIFQDFAEKYPMTGMVLNGK AVCCMHMGSFDEAETLLLEALNKACIECPDLH*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |