Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0612600_circ_g.3 |
ID in PlantcircBase | osa_circ_025199 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 31066284-31066702 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os04g0612600 |
Parent gene annotation |
Similar to Coatomer-like protein, epsilon subunit. (Os04t0612600 -01);Similar to Coatomer-like protein, epsilon subunit. (Os04t06 12600-02) |
Parent gene strand | - |
Alternative splicing | Os04g0612600_circ_g.1 Os04g0612600_circ_g.2 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os04t0612600-01:2 Os04t0612600-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.418584149 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
31066700-31066408(+) 31066696-31066413(+) 31066673-31066675(-) |
Potential amino acid sequence |
MPCSMLRVKESQPHQSSPCAYSKLPCHLEPFLSSGIFQQSLGI*(+) MHALFNASSKRVSASSKLPMCIQQTALPFRTIPVIGYFSAKSWNMR*(+) MHRSDYAEKQLKIMQQIDEDHTLTQLANAWLDIAVGGSKIREAYLIFQDFAEKYPMTGMVLNGK AVCCMHMGSFDEAETLLLEALNKACIECPDLH*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |