Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d053841_circ_g.2 |
| ID in PlantcircBase | zma_circ_008316 |
| Alias | zma_circ_0001745, GRMZM2G119640_C1 |
| Organism | Zea mays |
| Position | chr4: 242146380-242146655 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | find_circ, CIRI2 |
| Parent gene | Zm00001d053841 |
| Parent gene annotation |
Zinc finger CCCH domain-containing protein 40 |
| Parent gene strand | - |
| Alternative splicing | Zm00001d053841_circ_g.1 |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d053841_T014:2 Zm00001d053841_T012:2 Zm00001d053841_T011:2 Zm00001d053841_T004:1 Zm00001d053841_T002:1 Zm00001d053841_T013:2 Zm00001d053841_T003:1 Zm00001d053841_T010:2 Zm00001d053841_T001:2 Zm00001d053841_T005:1 Zm00001d053841_T008:2 Zm00001d053841_T015:2 Zm00001d053841_T009:2 Zm00001d053841_T007:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.151982961 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
242146644-242146432(+) 242146401-242146655(-) |
| Potential amino acid sequence |
MPHFTPREIYHHAKVPCPVLFV*(+) MINLSWSEMRHDKKPDDGETNSSRSLSVSDNNDDRKKETLLSGDDKEDHEIQLKQIRQDMELLR DDKSLLE*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Ma et al., 2021b;Zhang et al., 2019 |