Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d053841_circ_g.2 |
ID in PlantcircBase | zma_circ_008316 |
Alias | zma_circ_0001745, GRMZM2G119640_C1 |
Organism | Zea mays |
Position | chr4: 242146380-242146655 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ, CIRI2 |
Parent gene | Zm00001d053841 |
Parent gene annotation |
Zinc finger CCCH domain-containing protein 40 |
Parent gene strand | - |
Alternative splicing | Zm00001d053841_circ_g.1 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d053841_T014:2 Zm00001d053841_T012:2 Zm00001d053841_T011:2 Zm00001d053841_T004:1 Zm00001d053841_T002:1 Zm00001d053841_T013:2 Zm00001d053841_T003:1 Zm00001d053841_T010:2 Zm00001d053841_T001:2 Zm00001d053841_T005:1 Zm00001d053841_T008:2 Zm00001d053841_T015:2 Zm00001d053841_T009:2 Zm00001d053841_T007:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.151982961 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
242146644-242146432(+) 242146401-242146655(-) |
Potential amino acid sequence |
MPHFTPREIYHHAKVPCPVLFV*(+) MINLSWSEMRHDKKPDDGETNSSRSLSVSDNNDDRKKETLLSGDDKEDHEIQLKQIRQDMELLR DDKSLLE*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Ma et al., 2021b;Zhang et al., 2019 |