Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0672100_circ_g.2 |
| ID in PlantcircBase | osa_circ_015929 |
| Alias | Os02circ21002 |
| Organism | Oryza sativa |
| Position | chr2: 27316690-27317050 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | SMALT, Segemehl |
| Parent gene | Os02g0672100 |
| Parent gene annotation |
C2H2-type zinc finger transcription factor, Promotion of floweri ng (Os02t0672100-01) |
| Parent gene strand | + |
| Alternative splicing | Os02g0672100_circ_g.3 |
| Support reads | 3 |
| Tissues | leaf and panicle |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0672100-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_004164* |
| PMCS | 0.139275092 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27316826-27316730(+) 27316878-27316779(+) |
| Potential amino acid sequence |
MASNSSAAAVAALFGIRDGDHEDQIKPLFAQQQQHHHHQPPMAPSNAAAAASAAGSAAGQAAVA APPAKKKRTLPASCSDGKSRKESCY*(+) MATMRTRLSRYLPSSSNTTTTSHLWRHPTPRRRLLRQGRRPVKRPWRRHQRRRREPYQLLAVTG NQEKKAATSPSQSSTRREKIPFCS*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015 |