Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0672100_circ_g.2 |
ID in PlantcircBase | osa_circ_015929 |
Alias | Os02circ21002 |
Organism | Oryza sativa |
Position | chr2: 27316690-27317050 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | SMALT, Segemehl |
Parent gene | Os02g0672100 |
Parent gene annotation |
C2H2-type zinc finger transcription factor, Promotion of floweri ng (Os02t0672100-01) |
Parent gene strand | + |
Alternative splicing | Os02g0672100_circ_g.3 |
Support reads | 3 |
Tissues | leaf and panicle |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0672100-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_004164* |
PMCS | 0.139275092 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
27316826-27316730(+) 27316878-27316779(+) |
Potential amino acid sequence |
MASNSSAAAVAALFGIRDGDHEDQIKPLFAQQQQHHHHQPPMAPSNAAAAASAAGSAAGQAAVA APPAKKKRTLPASCSDGKSRKESCY*(+) MATMRTRLSRYLPSSSNTTTTSHLWRHPTPRRRLLRQGRRPVKRPWRRHQRRRREPYQLLAVTG NQEKKAATSPSQSSTRREKIPFCS*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015 |