Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Solyc06g061020.2_circ_g.3 |
ID in PlantcircBase | sly_circ_001981 |
Alias | 6:35406149|35406465 |
Organism | Solanum lycopersicum |
Position | chr6: 39016249-39016565 JBrowse» |
Reference genome | SL2.50.38 |
Type | e-circRNA |
Identification method | CIRI |
Parent gene | Solyc06g061020.2 |
Parent gene annotation |
protein_coding |
Parent gene strand | - |
Alternative splicing | Solyc06g061020.2_circ_g.1 Solyc06g061020.2_circ_g.2 Solyc06g061020.2_circ_g.4 |
Support reads | 8 |
Tissues | fruit |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Solyc06g061020.2.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.783314691 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
39016508-39016505(-) |
Potential amino acid sequence |
MNPSMQSQPQLIDLTQLHTNPNVVSTGLRLASGEQLQHHQKQQQQNQHSLSPQSSQSSAFYSIF TEDMSTIIKQHRDEIEQFLHVQLALIIIRRVREEEKLAPPLQ*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | fruit ripening |
Other Information | |
---|---|
References | Yin et al., 2018 |