Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0700500_circ_g.1 |
| ID in PlantcircBase | osa_circ_032192 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 29463135-29464400 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0700500 |
| Parent gene annotation |
Protein of unknown function DUF266, plant family protein. (Os06t 0700500-01);Protein of unknown function DUF266, plant family pro tein. (Os06t0700500-02) |
| Parent gene strand | - |
| Alternative splicing | Os06g0700500_circ_g.2 |
| Support reads | 2 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0700500-02:5 Os06t0700500-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.157909946 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29464356-29463148(+) 29464356-29464397(-) 29463384-29464397(-) |
| Potential amino acid sequence |
MIRISACSMWTRIVKTLHCL*(+) MLPEIVKRDWRKGAQWFTVKRQHAVLILSDFLYYAKFKRYCKPGNEWHNCYSDEHYLPTLFNMV DPTGIANWSVTHVDWSEGKWHPKAYRAVDTSFELLKNISSIDESIHVTSNAKF*(-) MLIGLKENGILKLTGLLTQALNCLRIFRPLMRVFMLQAMQSFDDPGPHGAGRYSDHMLPEIVKR DWRKGAQWFTVKRQHAVLILSDFLYYAKFKRYCKPGNEWHNCYSDEHYLPTLFNMVDPTGIANW SVTHVDWSEGKWHPKAYRAVDTSFELLKNISSIDESIHVTSNAKF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |